Loading...
Statistics
Advertisement

Stonelegacy.com

Advertisement
Stonelegacy.com is hosted in United States / New York . Stonelegacy.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Html5, Javascript, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Stonelegacy.com

Technology

Number of occurences: 3
  • Html
  • Html5
  • Javascript

Advertisement

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Stonelegacy.com

Missing HTTPS protocol.

    Meta - Stonelegacy.com

    Number of occurences: 3
    • Name:
      Content: 0; url=/legacy
    • Name: viewport
      Content: width=device-width, initial-scale=1
    • Name: description
      Content: See related links to what you are looking for.

    Server / Hosting

    • IP: 199.59.243.120
    • Latitude: 40.74
    • Longitude: -73.98
    • Country: United States
    • City: New York

    Rname

    • ns1.bodis.com
    • ns2.bodis.com

    Target

    • dnsadmin.bodis.com

    HTTP Header Response

    HTTP/1.1 200 OK Content-Type: text/html Last-Modified: Tue, 06 Sep 2016 19:25:26 GMT Accept-Ranges: bytes ETag: "0d7806b748d21:0" Server: Microsoft-IIS/7.5 X-Powered-By: ASP.NET Date: Sat, 15 Oct 2016 15:27:24 GMT Content-Length: 2423 X-Cache: MISS from s_hv1027 Via: 1.1 s_hv1027 (squid/3.5.20) Connection: keep-alive

    DNS

    host: stonelegacy.com
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 199.59.243.120
    host: stonelegacy.com
    1. class: IN
    2. ttl: 10800
    3. type: NS
    4. target: ns1.bodis.com
    host: stonelegacy.com
    1. class: IN
    2. ttl: 10800
    3. type: NS
    4. target: ns2.bodis.com
    host: stonelegacy.com
    1. class: IN
    2. ttl: 10800
    3. type: SOA
    4. mname: ns1.bodis.com
    5. rname: dnsadmin.bodis.com
    6. serial: 2016100803
    7. refresh: 10800
    8. retry: 3600
    9. expire: 1209600
    10. minimum-ttl: 3600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.tonelegacy.com, www.setonelegacy.com, www.etonelegacy.com, www.swtonelegacy.com, www.wtonelegacy.com, www.sdtonelegacy.com, www.dtonelegacy.com, www.sxtonelegacy.com, www.xtonelegacy.com, www.sftonelegacy.com, www.ftonelegacy.com, www.sgtonelegacy.com, www.gtonelegacy.com, www.sttonelegacy.com, www.ttonelegacy.com, www.sonelegacy.com, www.stqonelegacy.com, www.sqonelegacy.com, www.staonelegacy.com, www.saonelegacy.com, www.st onelegacy.com, www.s onelegacy.com, www.stwonelegacy.com, www.swonelegacy.com, www.steonelegacy.com, www.seonelegacy.com, www.stzonelegacy.com, www.szonelegacy.com, www.stxonelegacy.com, www.sxonelegacy.com, www.stconelegacy.com, www.sconelegacy.com, www.stnelegacy.com, www.stobnelegacy.com, www.stbnelegacy.com, www.stohnelegacy.com, www.sthnelegacy.com, www.stognelegacy.com, www.stgnelegacy.com, www.stojnelegacy.com, www.stjnelegacy.com, www.stomnelegacy.com, www.stmnelegacy.com, www.sto nelegacy.com, www.st nelegacy.com, www.stovnelegacy.com, www.stvnelegacy.com, www.stoelegacy.com, www.stonnelegacy.com, www.stonelegacy.com, www.stonhelegacy.com, www.stohelegacy.com, www.stonjelegacy.com, www.stojelegacy.com, www.stonkelegacy.com, www.stokelegacy.com, www.stonlelegacy.com, www.stolelegacy.com, www.ston elegacy.com, www.sto elegacy.com, www.stonlegacy.com, www.stonexlegacy.com, www.stonxlegacy.com, www.stoneslegacy.com, www.stonslegacy.com, www.stonewlegacy.com, www.stonwlegacy.com, www.stonerlegacy.com, www.stonrlegacy.com, www.stoneflegacy.com, www.stonflegacy.com, www.stonevlegacy.com, www.stonvlegacy.com, www.stoneclegacy.com, www.stonclegacy.com, www.stoneqlegacy.com, www.stonqlegacy.com, www.stonealegacy.com, www.stonalegacy.com, www.stoneylegacy.com, www.stonylegacy.com, www.stoneegacy.com, www.stoneluegacy.com, www.stoneuegacy.com, www.stonel8egacy.com, www.stone8egacy.com, www.stonel9egacy.com, www.stone9egacy.com, www.stoneljegacy.com, www.stonejegacy.com, www.stonel0egacy.com, www.stone0egacy.com, www.stonelmegacy.com, www.stonemegacy.com, www.stonelpegacy.com, www.stonepegacy.com, www.stoneloegacy.com, www.stoneoegacy.com, www.stonelgacy.com, www.stonelexgacy.com, www.stonelxgacy.com, www.stonelesgacy.com, www.stonelsgacy.com, www.stonelewgacy.com, www.stonelwgacy.com, www.stonelergacy.com, www.stonelrgacy.com, www.stonelefgacy.com, www.stonelfgacy.com, www.stonelevgacy.com, www.stonelvgacy.com, www.stonelecgacy.com, www.stonelcgacy.com, www.stoneleqgacy.com, www.stonelqgacy.com, www.stoneleagacy.com, www.stonelagacy.com, www.stoneleygacy.com, www.stonelygacy.com, www.stoneleacy.com, www.stonelegsacy.com, www.stonelesacy.com, www.stonelegxacy.com, www.stonelexacy.com, www.stonelegyacy.com, www.stoneleyacy.com, www.stoneleghacy.com, www.stonelehacy.com, www.stonelegnacy.com, www.stonelenacy.com, www.stonelegcacy.com, www.stonelecacy.com, www.stonelegdacy.com, www.stoneledacy.com, www.stonelegeacy.com, www.stoneleeacy.com, www.stonelegracy.com, www.stoneleracy.com, www.stonelegtacy.com, www.stoneletacy.com, www.stonelegbacy.com, www.stonelebacy.com, www.stonelegvacy.com, www.stonelevacy.com, www.stonelegcy.com, www.stonelegaocy.com, www.stonelegocy.com, www.stonelegapcy.com, www.stonelegpcy.com, www.stonelega9cy.com, www.stoneleg9cy.com, www.stonelegacy.com, www.stonelegcy.com, www.stonelegaicy.com, www.stonelegicy.com, www.stonelegaucy.com, www.stonelegucy.com, www.stonelegacdy.com, www.stonelegady.com, www.stonelegacry.com, www.stonelegary.com, www.stonelegacty.com, www.stonelegaty.com, www.stonelegacvy.com, www.stonelegavy.com, www.stonelegacfy.com, www.stonelegafy.com, www.stonelegacgy.com, www.stonelegagy.com, www.stonelegachy.com, www.stonelegahy.com, www.stonelegacny.com, www.stonelegany.com, www.stonelegacmy.com, www.stonelegamy.com, www.stonelegacjy.com, www.stonelegajy.com,

    Other websites we recently analyzed

    1. EGreen (Pvt) Ltd
      Mountain View (United States) - 64.233.166.214
      Server software: GSE
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 2
    2. computersnetworkssolutions.com
      Gloucester (United Kingdom) - 213.171.195.105
      Server software: nginx/1.10.1
      Technology: CSS, Html, Html5, Javascript
      Number of meta tags: 5
    3. تااوکه - سایت خبری استان بوشهر
      تااوکه - سایت خبری استان بوشهر
      Iran, Islamic Republic of - 92.50.2.106
      Server software: Apache/2
      Technology: CSS, Html, Javascript, MooTools, Php
      Number of Javascript: 2
      Number of meta tags: 5
    4. Teleskope und Zubehör | Wolfgang Lille – Spezialist für SONNE – Verkauf und Beratung
      Berlin (Germany) - 81.169.145.66
      Server software: Apache/2.2.31 (Unix)
      Technology: CSS, Flexslider, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 8
      Number of meta tags: 3
    5. hrprofession.co
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    6. Easton Sports Group
      Houston (United States) - 192.185.138.32
      Server software: nginx/1.10.0
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Pingback, Wordpress
      Number of Javascript: 11
      Number of meta tags: 2
    7. meada.com
      Switzerland - 141.8.224.25
      Server software: Apache
      Technology: Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    8. melonella.com
      Dublin (Ireland) - 46.137.111.230
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: Html
    9. Klettertreff.org
      Herzfond
      Austria - 84.116.32.65
      Server software: Apache
      Technology: Html
      Number of meta tags: 4
    10. kasimpasalikemalefendivakfi.info | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html

    Check Other Websites